Explicit
Episode 57 - The Montage
Explicit
3RPG Podcast by Jay Underwood, Sandra Rosner, & Chris Takasaki
Episode notes
Playing with the passage of time is part of storytelling, but what if you want some of those details are still essential? Queue the montage! In today's episode, the 3RPG hosts break down the what, when, hows of planning a riveting sequence without boring your players.
Comments:
- Sandra's character did not, in fact, die that night.
Timestamps:
00:00 Intro
5:25 - What is a montage?
12:15 - Risks of montage
16:30 - When to use a montage?
18:44 - Types of montage
26:09 - Rules of montage
28:22 - Dear GM - Party runs from encounters
30:21 - Montage and music
31:49 - Planning vs. improv
36:59 - Controlling tension
41:27 - The curse of the montage (campaign idea)
Want more 3RPG shenanigans?
Find us on these additional platforms:
Spotify: ...
Keywords
dungeonsanddragons dndgamingttrpgrpgtabletopttrpginspirationfantasyttrpgtipsdm3rpghomebrewhomebrewdndrpgadayttrpgadvicetrpggmttrpgpodcastindiesupportindiesupportindiedevelopersindiegamesttrpgcomedy