Episode 57 - The Montage
Esplicito

Episode 57 - The Montage

Esplicito

3RPG Podcast di Jay Underwood, Sandra Rosner, & Chris Takasaki

Note sull'episodio

Playing with the passage of time is part of storytelling, but what if you want some of those details are still essential? Queue the montage! In today's episode, the 3RPG hosts break down the what, when, hows of planning a riveting sequence without boring your players.

Comments:

- Sandra's character did not, in fact, die that night.

Timestamps:

00:00 Intro

5:25 - What is a montage?

12:15 - Risks of montage

16:30 - When to use a montage?

18:44 - Types of montage

26:09 - Rules of montage

28:22 - Dear GM - Party runs from encounters

30:21 - Montage and music

31:49 - Planning vs. improv

36:59 - Controlling tension

41:27 - The curse of the montage (campaign idea)

Want more 3RPG shenanigans?

Find us on these additional platforms:

Spotify:  ... 

Leggi dettagli
Parole chiave
dungeonsanddragons dndgamingttrpgrpgtabletopttrpginspirationfantasyttrpgtipsdm3rpghomebrewhomebrewdndrpgadayttrpgadvicetrpggmttrpgpodcastindiesupportindiesupportindiedevelopersindiegamesttrpgcomedy